PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G24370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 373aa    MW: 40195.5 Da    PI: 7.7344
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G24370.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.62.9e-1877124148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg W++eEde+lv+++  +G g+W++++r  g+ R++k+c++rw +yl
  LPERR01G24370.1  77 RGLWSPEEDEKLVKYISTHGHGCWSSVPRQAGLQRCGKSCRLRWINYL 124
                      788*******************************************97 PP

2Myb_DNA-binding52.61.1e-16130173146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T++E+ l++++++ lG++ W+ Ia++++ gRt++++k++w++
  LPERR01G24370.1 130 RGSFTQQEEALIIELHRVLGNR-WAQIAKHLP-GRTDNEVKNFWNS 173
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-2669127IPR009057Homeodomain-like
PROSITE profilePS5129418.81772124IPR017930Myb domain
SuperFamilySSF466898.24E-3075171IPR009057Homeodomain-like
SMARTSM007171.5E-1376126IPR001005SANT/Myb domain
PfamPF002494.0E-1677124IPR001005SANT/Myb domain
CDDcd001673.65E-1280124No hitNo description
PROSITE profilePS5129426.928125179IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-26128180IPR009057Homeodomain-like
SMARTSM007176.3E-17129177IPR001005SANT/Myb domain
PfamPF002492.3E-15130173IPR001005SANT/Myb domain
CDDcd001672.43E-12132172No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MLLICLPLRC SENGMQAVGV FAQLLPLSLL YNHVTTEKLG VKRDHERELA SRQYTVSESE  60
AREMGHHSCC NRQKVRRGLW SPEEDEKLVK YISTHGHGCW SSVPRQAGLQ RCGKSCRLRW  120
INYLRPDLKR GSFTQQEEAL IIELHRVLGN RWAQIAKHLP GRTDNEVKNF WNSTIKKKLI  180
SQAVGSLHPS PADLYYNILD GAGQSIAAAA AAGCASLNAL DNAAHGLAQS PPSSVHNSAA  240
WATSNFSSHQ QQIFLPGHAV GDLQYAAAVD GEFVRLCRAA EGYQDINGAA GIVGQCKPSD  300
LLAQDGVVAR SCGFPAFVEQ KGAAAAGAFL ADPGMGPVMD FMDAILGSSS TSAASASSAE  360
TFSANTAMQP HWI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-33771797108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2884870.0AK288487.1 Oryza sativa Japonica Group cDNA, clone: J090040H24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015694862.11e-175PREDICTED: myb-related protein 340-like
TrEMBLA0A0D9V4T00.0A0A0D9V4T0_9ORYZ; Uncharacterized protein
STRINGBGIOSGA004306-PA1e-178(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128133035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.21e-75myb domain protein 26